Lineage for d1h9ca_ (1h9c A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1599665Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 1599779Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) (S)
  5. 1599780Family c.44.2.1: PTS system, Lactose/Cellobiose specific IIB subunit [52795] (3 proteins)
    Pfam PF02302
  6. 1599781Protein Enzyme IIB-cellobiose [52796] (1 species)
    of the phosphoenol-pyruvate dependent phosphotransferase system
  7. 1599782Species Escherichia coli [TaxId:562] [52797] (3 PDB entries)
  8. 1599785Domain d1h9ca_: 1h9c A: [60820]

Details for d1h9ca_

PDB Entry: 1h9c (more details)

PDB Description: nmr structure of cysteinyl-phosphorylated enzyme iib of the n,n'- diacetylchitobiose specific phosphoenolpyruvate-dependent phosphotransferase system of escherichia coli.
PDB Compounds: (A:) pts system, chitobiose-specific iib component

SCOPe Domain Sequences for d1h9ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9ca_ c.44.2.1 (A:) Enzyme IIB-cellobiose {Escherichia coli [TaxId: 562]}
mekkhiylfcsagmstsllvskmraqaekyevpviieafpetlagekgqnadvvllgpqi
aymlpeiqrllpnkpvevidsllygkvdglgvlkaavaaikkaaan

SCOPe Domain Coordinates for d1h9ca_:

Click to download the PDB-style file with coordinates for d1h9ca_.
(The format of our PDB-style files is described here.)

Timeline for d1h9ca_: