Lineage for d1h8vc_ (1h8v C:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 165029Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 165030Protein Endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (2 species)
  7. 165034Species Trichoderma reesei, Cel12A [TaxId:51453] [63731] (1 PDB entry)
  8. 165037Domain d1h8vc_: 1h8v C: [60797]

Details for d1h8vc_

PDB Entry: 1h8v (more details), 1.9 Å

PDB Description: the x-ray crystal structure of the trichoderma reesei family 12 endoglucanase 3, cel12a, at 1.9 a resolution

SCOP Domain Sequences for d1h8vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8vc_ b.29.1.11 (C:) Endo-1,4-beta-glucanase (cellulase) catalytic domain {Trichoderma reesei, Cel12A}
etscdqwatftgngytvsnnlwgasagsgfgcvtavslsggaswhadwqwsggqnnvksy
qnsqiaipqkrtvnsissmpttaswsysgsniranvaydlftaanpnhvtysgdyelmiw
lgkygdigpigssqgtvnvggqswtlyygyngamqvysfvaqtnttnysgdvknffnylr
dnkgynaagqyvlsyqfgtepftgsgtlnvaswtasin

SCOP Domain Coordinates for d1h8vc_:

Click to download the PDB-style file with coordinates for d1h8vc_.
(The format of our PDB-style files is described here.)

Timeline for d1h8vc_: