Lineage for d1h8i.1 (1h8i L:,H:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins) 
Protein Thrombin [50531] (2 species) Species Human (Homo sapiens) [TaxId:9606] [50532] (130 PDB entries) 
Domain d1h8i.1: 1h8i L:,H: [60778]
Details for d1h8i.1
PDB Entry: 1h8i (more details), 1.75 Å
PDB Description: x-ray crystal structure of human alpha-thrombin with a tripeptide phosphonate inhibitor.
SCOP Domain Sequences for d1h8i.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1h8i.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens)}
adcglrplfekksledkterellesyiXivegsdaeigmspwqvmlfrkspqellcgasl
isdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihprynw
renldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwgqps
vlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfnnr
wyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge
SCOP Domain Coordinates for d1h8i.1:
Click to download the PDB-style file with coordinates for d1h8i.1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h8i.1:
- d1h8i.1 first appeared in SCOP 1.57
- d1h8i.1 appears in SCOP 1.59
- d1h8i.1 appears in SCOP 1.63
- d1h8i.1 appears in the current release, SCOPe 2.08
View in 3D