Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88780] (12 PDB entries) Uniprot P00829 |
Domain d1h8ee3: 1h8e E:82-357 [60752] Other proteins in same PDB: d1h8ea1, d1h8ea2, d1h8ea3, d1h8eb1, d1h8eb2, d1h8eb3, d1h8ec1, d1h8ec2, d1h8ec3, d1h8ed1, d1h8ed2, d1h8ee1, d1h8ee2, d1h8ef1, d1h8ef2, d1h8eg_, d1h8eh_, d1h8ei_ complexed with adp, alf, gol, mg, so4 |
PDB Entry: 1h8e (more details), 2 Å
SCOPe Domain Sequences for d1h8ee3:
Sequence, based on SEQRES records: (download)
>d1h8ee3 c.37.1.11 (E:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa pattfahldattvlsraiaelgiypavdpldstsri
>d1h8ee3 c.37.1.11 (E:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemeqeilvtgikvvdll apyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemies gvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrftq agsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpapa ttfahldattvlsraiaelgiypavdpldstsri
Timeline for d1h8ee3: