SCOP 1.59: Domain d1h4tc3: 1h4t C:404-477

Lineage for d1h4tc3 (1h4t C:404-477)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.56: C-terminal domain of ProRS [64585] (1 superfamily)

4. Superfamily g.56.1: C-terminal domain of ProRS [64586] (1 family)

5. Family g.56.1.1: C-terminal domain of ProRS [64587] (1 protein)

6. Protein C-terminal domain of ProRS [64588] (1 species)

7. Species Thermus thermophilus [TaxId:274] [64589] (4 PDB entries)

8. Domain d1h4tc3: 1h4t C:404-477 [60618]
   Other proteins in same PDB: d1h4ta1, d1h4ta2, d1h4tb1, d1h4tb2, d1h4tc1, d1h4tc2, d1h4td1, d1h4td2

Details for d1h4tc3

PDB Entry: 1h4t, 2.9 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus complexed with l-proline

SCOP Domain Sequences for d1h4tc3:

Sequence; same for both SEQRES and ATOM records:

>d1h4tc3 g.56.1.1 (C:404-477) C-terminal domain of ProRS {Thermus thermophilus}
trkvdtyeafkeavqegfalafhcgdkacerliqeettattrcvpfeaepeegfcvrcgr
psaygkrvvfakay

Timeline for d1h4tc3:

• d1h4tc3 first appeared in SCOP 1.57
  
• d1h4tc3 appears in SCOP 1.61
  
• d1h4tc3 appears in the current release, SCOPe 2.08