Lineage for d1h4sa3 (1h4s A:404-477)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656170Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 1656450Superfamily d.68.5: C-terminal domain of ProRS [64586] (1 family) (S)
    contains a metal (zinc)-binding site
  5. 1656451Family d.68.5.1: C-terminal domain of ProRS [64587] (1 protein)
  6. 1656452Protein C-terminal domain of ProRS [64588] (3 species)
  7. 1656463Species Thermus thermophilus [TaxId:274] [64589] (4 PDB entries)
  8. 1656472Domain d1h4sa3: 1h4s A:404-477 [60606]
    Other proteins in same PDB: d1h4sa1, d1h4sa2, d1h4sb1, d1h4sb2
    protein/RNA complex; complexed with psd, so4, zn

Details for d1h4sa3

PDB Entry: 1h4s (more details), 2.85 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus complexed with trnapro(cgg) and a prolyl-adenylate analogue
PDB Compounds: (A:) prolyl-tRNA synthetase

SCOPe Domain Sequences for d1h4sa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4sa3 d.68.5.1 (A:404-477) C-terminal domain of ProRS {Thermus thermophilus [TaxId: 274]}
trkvdtyeafkeavqegfalafhcgdkacerliqeettattrcvpfeaepeegfcvrcgr
psaygkrvvfakay

SCOPe Domain Coordinates for d1h4sa3:

Click to download the PDB-style file with coordinates for d1h4sa3.
(The format of our PDB-style files is described here.)

Timeline for d1h4sa3: