SCOPe 2.04: Domain d1h4qb3: 1h4q B:404-477

Lineage for d1h4qb3 (1h4q B:404-477)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.5: C-terminal domain of ProRS [64586] (1 family)
   contains a metal (zinc)-binding site

5. Family d.68.5.1: C-terminal domain of ProRS [64587] (1 protein)

6. Protein C-terminal domain of ProRS [64588] (3 species)

7. Species Thermus thermophilus [TaxId:274] [64589] (4 PDB entries)

8. Domain d1h4qb3: 1h4q B:404-477 [60603]
   Other proteins in same PDB: d1h4qa1, d1h4qa2, d1h4qb1, d1h4qb2
   protein/RNA complex; complexed with atp, pri, so4, zn

Details for d1h4qb3

PDB Entry: 1h4q, 3 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus complexed with trnapro(cgg), atp and prolinol

PDB Compounds: (B:) prolyl-tRNA synthetase

SCOPe Domain Sequences for d1h4qb3:

Sequence; same for both SEQRES and ATOM records:

>d1h4qb3 d.68.5.1 (B:404-477) C-terminal domain of ProRS {Thermus thermophilus [TaxId: 274]}
trkvdtyeafkeavqegfalafhcgdkacerliqeettattrcvpfeaepeegfcvrcgr
psaygkrvvfakay

Timeline for d1h4qb3:

• d1h4qb3 first appeared in SCOP 1.57
  
• d1h4qb3 appears in SCOPe 2.03
  
• d1h4qb3 appears in SCOPe 2.05
  
• d1h4qb3 appears in the current release, SCOPe 2.08