Lineage for d1h4qb1 (1h4q B:277-403)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489766Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2489767Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2489768Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 2489814Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species)
  7. 2489825Species Thermus thermophilus [TaxId:274] [64072] (4 PDB entries)
  8. 2489837Domain d1h4qb1: 1h4q B:277-403 [60601]
    Other proteins in same PDB: d1h4qa2, d1h4qa3, d1h4qb2, d1h4qb3
    protein/RNA complex; complexed with atp, pri, so4, zn

Details for d1h4qb1

PDB Entry: 1h4q (more details), 3 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus complexed with trnapro(cgg), atp and prolinol
PDB Compounds: (B:) prolyl-tRNA synthetase

SCOPe Domain Sequences for d1h4qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4qb1 c.51.1.1 (B:277-403) Prolyl-tRNA synthetase (ProRS) domain {Thermus thermophilus [TaxId: 274]}
rglvlpprlapiqvvivpiykdesrervleaaqglrqallaqglrvhlddrdqhtpgykf
hewelkgvpfrvelgpkdleggqavlasrlggketlplaalpealpgkldafheelyrra
lafredh

SCOPe Domain Coordinates for d1h4qb1:

Click to download the PDB-style file with coordinates for d1h4qb1.
(The format of our PDB-style files is described here.)

Timeline for d1h4qb1: