Lineage for d1giyd_ (1giy D:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2647135Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2647136Protein 70S ribosome functional complex [58121] (4 species)
  7. 2647693Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 2647807Domain d1giyd_: 1giy D: [60551]

Details for d1giyd_

PDB Entry: 1giy (more details), 5.5 Å

PDB Description: crystal structure of the ribosome at 5.5 a resolution. this file, 1giy, contains the 50s ribosome subunit. the 30s ribosome subunit, three trna, and mrna molecules are in the file 1gix
PDB Compounds: (D:) 50S ribosomal protein L2

SCOPe Domain Sequences for d1giyd_:

Sequence, based on SEQRES records: (download)

>d1giyd_ i.1.1.1 (D:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp
dadikignalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasge
vrmilgkcratvgevgnggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfg

Sequence, based on observed residues (ATOM records): (download)

>d1giyd_ i.1.1.1 (D:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp
dadikignalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasge
vrmilgkcratvgevgnggrtdkpfvkagnkhhkmkapnvrgvamnavdhpfg

SCOPe Domain Coordinates for d1giyd_:

Click to download the PDB-style file with coordinates for d1giyd_.
(The format of our PDB-style files is described here.)

Timeline for d1giyd_: