SCOP 1.61: Domain d1gh0v_: 1gh0 V:

Lineage for d1gh0v_ (1gh0 V:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.3: Phycocyanin-like [46532] (4 proteins)

6. Protein Phycocyanin [46533] (5 species)

7. Species Spirulina platensis [TaxId:118562] [63444] (2 PDB entries)

8. Domain d1gh0v_: 1gh0 V: [60512]

Details for d1gh0v_

PDB Entry: 1gh0, 2.2 Å

PDB Description: crystal structure of c-phycocyanin from spirulina platensis

SCOP Domain Sequences for d1gh0v_:

Sequence; same for both SEQRES and ATOM records:

>d1gh0v_ a.1.1.3 (V:) Phycocyanin {Spirulina platensis}
mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldvvnritsnastivsnaarslf
aeqpqliapggnaytsrrmaaclrdmeiilryvtyavfagdasvledrclnglretylal
gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiagyfdraaaavs

Timeline for d1gh0v_:

• d1gh0v_ first appeared in SCOP 1.57
  
• d1gh0v_ appears in SCOP 1.59
  
• d1gh0v_ appears in SCOP 1.63
  
• d1gh0v_ appears in the current release, SCOPe 2.08