Class b: All beta proteins [48724] (174 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Cellular retinol-binding protein III [63811] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63812] (1 PDB entry) |
Domain d1gglb_: 1ggl B: [60485] |
PDB Entry: 1ggl (more details), 2.31 Å
SCOPe Domain Sequences for d1gglb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gglb_ b.60.1.2 (B:) Cellular retinol-binding protein III {Human (Homo sapiens) [TaxId: 9606]} ppnltgyyrfvsqknmedylqalnislavrkialllkpdkeiehqgnhmtvrtlstfrny tvqfdvgvefeedlrsvdgrkcqtivtweeehlvcvqkgevpnrgwrhwlegemlylelt ardavceqvfrkvh
Timeline for d1gglb_: