Lineage for d1gefd_ (1gef D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397005Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 397006Superfamily c.52.1: Restriction endonuclease-like [52980] (22 families) (S)
  5. 397199Family c.52.1.18: Archaeal Holliday junction resolvase Hjc [64080] (1 protein)
  6. 397200Protein Archaeal Holliday junction resolvase Hjc [64081] (2 species)
  7. 397201Species Archaeon Pyrococcus furiosus [TaxId:2261] [64082] (2 PDB entries)
  8. 397204Domain d1gefd_: 1gef D: [60467]

Details for d1gefd_

PDB Entry: 1gef (more details), 2 Å

PDB Description: Crystal structure of the archaeal holliday junction resolvase HJC

SCOP Domain Sequences for d1gefd_:

Sequence, based on SEQRES records: (download)

>d1gefd_ c.52.1.18 (D:) Archaeal Holliday junction resolvase Hjc {Archaeon Pyrococcus furiosus}
myrkgaqaerelikllekhgfavvrsagskkvdlvagngkkylcievkvtkkdhlyvgkr
dmgrliefsrrfggipvlavkflnvgwrfievspkiekfvftpssgvslevllgiq

Sequence, based on observed residues (ATOM records): (download)

>d1gefd_ c.52.1.18 (D:) Archaeal Holliday junction resolvase Hjc {Archaeon Pyrococcus furiosus}
myrkgaqaerelikllekhgfavvrsagskkvdlvagngkkylcievkvtkkdhlyvgkr
dmgrliefsrrfggipvlavkfwrfievspkfvftpssgvslevllgiq

SCOP Domain Coordinates for d1gefd_:

Click to download the PDB-style file with coordinates for d1gefd_.
(The format of our PDB-style files is described here.)

Timeline for d1gefd_: