SCOP 1.67: Domain d1gefd_: 1gef D:

Lineage for d1gefd_ (1gef D:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (22 families)

5. Family c.52.1.18: Archaeal Holliday junction resolvase Hjc [64080] (1 protein)

6. Protein Archaeal Holliday junction resolvase Hjc [64081] (2 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [64082] (2 PDB entries)

8. Domain d1gefd_: 1gef D: [60467]

Details for d1gefd_

PDB Entry: 1gef, 2 Å

PDB Description: Crystal structure of the archaeal holliday junction resolvase HJC

SCOP Domain Sequences for d1gefd_:

Sequence, based on SEQRES records:

>d1gefd_ c.52.1.18 (D:) Archaeal Holliday junction resolvase Hjc {Archaeon Pyrococcus furiosus}
myrkgaqaerelikllekhgfavvrsagskkvdlvagngkkylcievkvtkkdhlyvgkr
dmgrliefsrrfggipvlavkflnvgwrfievspkiekfvftpssgvslevllgiq

Sequence, based on observed residues (ATOM records):

>d1gefd_ c.52.1.18 (D:) Archaeal Holliday junction resolvase Hjc {Archaeon Pyrococcus furiosus}
myrkgaqaerelikllekhgfavvrsagskkvdlvagngkkylcievkvtkkdhlyvgkr
dmgrliefsrrfggipvlavkfwrfievspkfvftpssgvslevllgiq

Timeline for d1gefd_:

• d1gefd_ first appeared in SCOP 1.57
  
• d1gefd_ appears in SCOP 1.65
  
• d1gefd_ appears in SCOP 1.69
  
• d1gefd_ appears in the current release, SCOPe 2.08