Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) |
Family c.52.1.18: Hjc-like [64080] (3 proteins) Pfam PF01870 |
Protein Archaeal Holliday junction resolvase Hjc [64081] (2 species) |
Species Pyrococcus furiosus [TaxId:2261] [64082] (2 PDB entries) |
Domain d1gefd_: 1gef D: [60467] complexed with so4 |
PDB Entry: 1gef (more details), 2 Å
SCOPe Domain Sequences for d1gefd_:
Sequence, based on SEQRES records: (download)
>d1gefd_ c.52.1.18 (D:) Archaeal Holliday junction resolvase Hjc {Pyrococcus furiosus [TaxId: 2261]} myrkgaqaerelikllekhgfavvrsagskkvdlvagngkkylcievkvtkkdhlyvgkr dmgrliefsrrfggipvlavkflnvgwrfievspkiekfvftpssgvslevllgiq
>d1gefd_ c.52.1.18 (D:) Archaeal Holliday junction resolvase Hjc {Pyrococcus furiosus [TaxId: 2261]} myrkgaqaerelikllekhgfavvrsagskkvdlvagngkkylcievkvtkkdhlyvgkr dmgrliefsrrfggipvlavkfwrfievspkfvftpssgvslevllgiq
Timeline for d1gefd_: