SCOPe 2.07: Domain d1gd3a_: 1gd3 A:

Lineage for d1gd3a_ (1gd3 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.2: Cystatins [54407] (7 proteins)
   automatically mapped to Pfam PF00031

6. Protein Cystatin A (stefin A) [54412] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54413] (12 PDB entries)

8. Domain d1gd3a_: 1gd3 A: [60437]

Details for d1gd3a_

PDB Entry: 1gd3

PDB Description: refined solution structure of human cystatin a

PDB Compounds: (A:) cystatin a

SCOPe Domain Sequences for d1gd3a_:

Sequence; same for both SEQRES and ATOM records:

>d1gd3a_ d.17.1.2 (A:) Cystatin A (stefin A) {Human (Homo sapiens) [TaxId: 9606]}
mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag
dnkylhlkvfkslpgqnedlvltgyqvdknkddeltgf

Timeline for d1gd3a_:

• d1gd3a_ first appeared in SCOP 1.57
  
• d1gd3a_ appears in SCOPe 2.06
  
• d1gd3a_ appears in the current release, SCOPe 2.08