Lineage for d1g8rb3 (1g8r B:178-236)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72494Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
  4. 72495Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) (S)
  5. 72508Family c.57.1.2: MoeA, central domain [64103] (1 protein)
  6. 72509Protein MoeA, central domain [64104] (1 species)
  7. 72510Species Escherichia coli [TaxId:562] [64105] (3 PDB entries)
  8. 72516Domain d1g8rb3: 1g8r B:178-236 [60382]
    Other proteins in same PDB: d1g8ra1, d1g8ra2, d1g8rb1, d1g8rb2

Details for d1g8rb3

PDB Entry: 1g8r (more details), 2.65 Å

PDB Description: moea

SCOP Domain Sequences for d1g8rb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8rb3 c.57.1.2 (B:178-236) MoeA, central domain {Escherichia coli}
vrvalfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraa

SCOP Domain Coordinates for d1g8rb3:

Click to download the PDB-style file with coordinates for d1g8rb3.
(The format of our PDB-style files is described here.)

Timeline for d1g8rb3: