Lineage for d1g8ra1 (1g8r A:237-409)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63938Fold b.85: beta-clip [51268] (6 superfamilies)
  4. 64058Superfamily b.85.6: Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63867] (1 family) (S)
  5. 64059Family b.85.6.1: Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63868] (1 protein)
  6. 64060Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (1 species)
  7. 64061Species Escherichia coli [TaxId:562] [63870] (3 PDB entries)
  8. 64066Domain d1g8ra1: 1g8r A:237-409 [60377]
    Other proteins in same PDB: d1g8ra2, d1g8ra3, d1g8rb2, d1g8rb3

Details for d1g8ra1

PDB Entry: 1g8r (more details), 2.65 Å

PDB Description: moea

SCOP Domain Sequences for d1g8ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8ra1 b.85.6.1 (A:237-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli}
fieadsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcg
lpgnpvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrn
adgelevtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfg

SCOP Domain Coordinates for d1g8ra1:

Click to download the PDB-style file with coordinates for d1g8ra1.
(The format of our PDB-style files is described here.)

Timeline for d1g8ra1: