SCOP 1.65: Domain d1g8ra1: 1g8r A:327-409

Lineage for d1g8ra1 (1g8r A:327-409)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.6: Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63867] (1 family)

5. Family b.85.6.1: Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63868] (1 protein)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (1 species)

7. Species Escherichia coli [TaxId:562] [63870] (3 PDB entries)

8. Domain d1g8ra1: 1g8r A:327-409 [60377]
   Other proteins in same PDB: d1g8ra2, d1g8ra3, d1g8rb2, d1g8rb3

Details for d1g8ra1

PDB Entry: 1g8r, 2.65 Å

PDB Description: moea

SCOP Domain Sequences for d1g8ra1:

Sequence; same for both SEQRES and ATOM records:

>d1g8ra1 b.85.6.1 (A:327-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli}
lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivl
erdrgnvevgewvevepfnalfg

Timeline for d1g8ra1:

• d1g8ra1 first appeared in SCOP 1.57
  
• d1g8ra1 appears in SCOP 1.63
  
• d1g8ra1 appears in SCOP 1.67
  
• d1g8ra1 appears in the current release, SCOPe 2.08