Lineage for d1g8mb2 (1g8m B:201-593)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 128585Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
  4. 128598Superfamily c.97.2: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64197] (1 family) (S)
  5. 128599Family c.97.2.1: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64198] (1 protein)
  6. 128600Protein AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64199] (1 species)
  7. 128601Species Chicken (Gallus gallus) [TaxId:9031] [64200] (1 PDB entry)
  8. 128603Domain d1g8mb2: 1g8m B:201-593 [60374]
    Other proteins in same PDB: d1g8ma1, d1g8mb1

Details for d1g8mb2

PDB Entry: 1g8m (more details), 1.75 Å

PDB Description: crystal structure of avian atic, a bifunctional transformylase and cyclohydrolase enzyme in purine biosynthesis at 1.75 ang. resolution

SCOP Domain Sequences for d1g8mb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8mb2 c.97.2.1 (B:201-593) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus)}
gvsqlplrygmnphqspaqlyttrpklpltvvngspgfinlcdalnawqlvkelkqalgi
paaasfkhvspagaavgiplseeeaqvcmvhdlhktltplasayarsrgadrmssfgdfi
alsdicdvptakiisrevsdgvvapgyeeealkilskkknggycvlqmdpnyepddneir
tlyglqlmqkrnnavidrslfknivtknktlpesavrdlivasiavkytqsnsvcyakdg
qvigigagqqsrihctrlagdkanswwlrhhprvlsmkfkagvkraevsnaidqyvtgti
gededlvkwqamfeevpaqlteaekkqwiakltavslssdaffpfrdnvdrakrigvqfi
vapsgsaadevvieacnelgitlihtnlrlfhh

SCOP Domain Coordinates for d1g8mb2:

Click to download the PDB-style file with coordinates for d1g8mb2.
(The format of our PDB-style files is described here.)

Timeline for d1g8mb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g8mb1