Lineage for d1g7ga_ (1g7g A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991569Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 991570Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 991642Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 991674Protein Tyrosine phosphatase [52806] (7 species)
  7. 991675Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (96 PDB entries)
    Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299
  8. 991760Domain d1g7ga_: 1g7g A: [60331]
    complexed with inx

Details for d1g7ga_

PDB Entry: 1g7g (more details), 2.2 Å

PDB Description: human ptp1b catalytic domain complexes with pnu179326
PDB Compounds: (A:) protein-tyrosine phosphatase, non-receptor type 1

SCOPe Domain Sequences for d1g7ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7ga_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed

SCOPe Domain Coordinates for d1g7ga_:

Click to download the PDB-style file with coordinates for d1g7ga_.
(The format of our PDB-style files is described here.)

Timeline for d1g7ga_: