SCOP 1.59: Domain d1g7a.1: 1g7a B:,A:

Lineage for d1g7a.1 (1g7a B:,A:)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (4 proteins)

6. Protein Insulin [56996] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56998] (50 PDB entries)

8. Domain d1g7a.1: 1g7a B:,A: [60322]

Details for d1g7a.1

PDB Entry: 1g7a, 1.2 Å

PDB Description: 1.2 a structure of t3r3 human insulin at 100 k

SCOP Domain Sequences for d1g7a.1:

Sequence; same for both SEQRES and ATOM records:

>g1g7a.1 g.1.1.1 (B:,A:) Insulin {Human (Homo sapiens)}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

Timeline for d1g7a.1:

• d1g7a.1 first appeared in SCOP 1.57
  
• d1g7a.1 appears in SCOP 1.61
  
• d1g7a.1 appears in the current release, SCOPe 2.08