Lineage for d1g63g_ (1g63 G:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592584Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1592585Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) (S)
  5. 1592586Family c.34.1.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52508] (4 proteins)
    Pfam PF02441; formerly DFP, DNA/pantothenate metabolism flavoprotein family
  6. 1592597Protein Epidermin modifying enzyme (peptidyl-cysteine decarboxylase) EpiD [63996] (1 species)
    binds FMN
  7. 1592598Species Staphylococcus epidermidis [TaxId:1282] [63997] (2 PDB entries)
  8. 1592605Domain d1g63g_: 1g63 G: [60305]
    complexed with fmn

Details for d1g63g_

PDB Entry: 1g63 (more details), 2.5 Å

PDB Description: peptidyl-cysteine decarboxylase epid
PDB Compounds: (G:) epidermin modifying enzyme epid

SCOPe Domain Sequences for d1g63g_:

Sequence, based on SEQRES records: (download)

>d1g63g_ c.34.1.1 (G:) Epidermin modifying enzyme (peptidyl-cysteine decarboxylase) EpiD {Staphylococcus epidermidis [TaxId: 1282]}
mygkllicatasinvininhyivelkqhfdevnilfspssknfintdvlklfcdnlydei
kdpllnhinivenheyilvlpasantinkiangicdnllttvcltgyqklfifpnmnirm
wgnpflqknidllknndvkvyspdmnksfeissgryknnitmpnienvlnfvln

Sequence, based on observed residues (ATOM records): (download)

>d1g63g_ c.34.1.1 (G:) Epidermin modifying enzyme (peptidyl-cysteine decarboxylase) EpiD {Staphylococcus epidermidis [TaxId: 1282]}
mygkllicatasinvininhyivelkqhfdevnilfspssknfintdvlklfcdnlydei
kdpllnhinivenheyilvlpasantinkiangicdnllttvcltgyqklfifpnmnirm
wgnpflqknidllknndvkvyspdmnknnitmpnienvlnfvln

SCOPe Domain Coordinates for d1g63g_:

Click to download the PDB-style file with coordinates for d1g63g_.
(The format of our PDB-style files is described here.)

Timeline for d1g63g_: