Lineage for d1g58a_ (1g58 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971984Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 2971985Superfamily d.115.1: YrdC/RibB [55821] (3 families) (S)
  5. 2972000Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins)
    contains one additional helix in the C-terminal extension
    automatically mapped to Pfam PF00926
  6. 2972001Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (4 species)
  7. 2972002Species Escherichia coli [TaxId:562] [64374] (3 PDB entries)
  8. 2972005Domain d1g58a_: 1g58 A: [60255]
    complexed with au

Details for d1g58a_

PDB Entry: 1g58 (more details), 1.55 Å

PDB Description: crystal structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase gold derivative
PDB Compounds: (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d1g58a_:

Sequence, based on SEQRES records: (download)

>d1g58a_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Escherichia coli [TaxId: 562]}
llssfgtpfervenalaalregrgvmvlddedrenegdmifpaetmtveqmaltirhgsg
ivclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrittvraaiad
gakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmar
apeciefankhnmalvtiedlvayrqahe

Sequence, based on observed residues (ATOM records): (download)

>d1g58a_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Escherichia coli [TaxId: 562]}
llssfgtpfervenalaalregrgvmvldnegdmifpaetmtveqmaltirhgsgivclc
itedrrkqldlpmmvegftvtieaaegvttgvsaadrittvraaiadgakpsdlnrpghv
fplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmarapeciefankhnm
alvtiedlvayrqahe

SCOPe Domain Coordinates for d1g58a_:

Click to download the PDB-style file with coordinates for d1g58a_.
(The format of our PDB-style files is described here.)

Timeline for d1g58a_: