SCOPe 2.06: Domain d1g3qa_: 1g3q A:

Lineage for d1g3qa_ (1g3q A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Cell division regulator MinD [64019] (3 species)

7. Species Pyrococcus furiosus [TaxId:2261] [64021] (2 PDB entries)

8. Domain d1g3qa_: 1g3q A: [60237]
   complexed with adp, mg

Details for d1g3qa_

PDB Entry: 1g3q, 2 Å

PDB Description: crystal structure analysis of pyrococcus furiosus cell division atpase mind

PDB Compounds: (A:) cell division inhibitor

SCOPe Domain Sequences for d1g3qa_:

Sequence; same for both SEQRES and ATOM records:

>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Pyrococcus furiosus [TaxId: 2261]}
mgriisivsgkggtgkttvtanlsvalgdrgrkvlavdgdltmanlslvlgvddpdvtlh
dvlageanvedaiymtqfdnvyvlpgavdwehvlkadprklpevikslkdkfdfilidcp
aglqldamsamlsgeeallvtnpeiscltdtmkvgivlkkaglailgfvlnrygrsdrdi
ppeaaedvmevpllavipedpairegtlegipavkykpeskgakafvklaeeiekla

Timeline for d1g3qa_:

• d1g3qa_ first appeared in SCOP 1.57
  
• d1g3qa_ appears in SCOPe 2.05
  
• d1g3qa_ appears in SCOPe 2.07
  
• d1g3qa_ appears in the current release, SCOPe 2.08