Lineage for d1g13a_ (1g13 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428782Fold b.95: Ganglioside M2 (gm2) activator [63706] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2428783Superfamily b.95.1: Ganglioside M2 (gm2) activator [63707] (1 family) (S)
  5. 2428784Family b.95.1.1: Ganglioside M2 (gm2) activator [63708] (1 protein)
  6. 2428785Protein Ganglioside M2 (gm2) activator [63709] (2 species)
  7. 2428786Species Human (Homo sapiens) [TaxId:9606] [63710] (8 PDB entries)
    Uniprot P17900 31-193
  8. 2428801Domain d1g13a_: 1g13 A: [60194]
    complexed with epe

Details for d1g13a_

PDB Entry: 1g13 (more details), 2 Å

PDB Description: human gm2 activator structure
PDB Compounds: (A:) ganglioside m2 activator protein

SCOPe Domain Sequences for d1g13a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g13a_ b.95.1.1 (A:) Ganglioside M2 (gm2) activator {Human (Homo sapiens) [TaxId: 9606]}
ssfswdncdegkdpavirsltlepdpiivpgnvtlsvmgstsvplssplkvdlvlekeva
glwikipctdyigsctfehfcdvldmliptgepcpeplrtyglpchcpfkegtyslpkse
fvvpdlelpswlttgnyriesvlsssgkrlgcikiaaslkgi

SCOPe Domain Coordinates for d1g13a_:

Click to download the PDB-style file with coordinates for d1g13a_.
(The format of our PDB-style files is described here.)

Timeline for d1g13a_: