Lineage for d1g0ib_ (1g0i B:)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 266544Fold e.7: Sugar phosphatases [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 266545Superfamily e.7.1: Sugar phosphatases [56655] (1 family) (S)
  5. 266546Family e.7.1.1: Sugar phosphatases [56656] (6 proteins)
  6. 266555Protein Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase [56665] (2 species)
  7. 266567Species Archaeon Methanococcus jannaschii, MJ0109 [56666] (3 PDB entries)
    MJ0109
  8. 266571Domain d1g0ib_: 1g0i B: [60174]
    complexed with ins, mn, po4

Details for d1g0ib_

PDB Entry: 1g0i (more details), 2.4 Å

PDB Description: crystal structure of mj0109 gene product inositol monophosphatase-fructose 1,6 bisphosphatase

SCOP Domain Sequences for d1g0ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0ib_ e.7.1.1 (B:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Methanococcus jannaschii, MJ0109}
mkwdeigkniakeiekeilpyfgrkdksyvvgtspsgdeteifdkisedialkylkslnv
nivseelgvidnssewtvvidpidgsfnfingipffafcfgvfknnepyygltyefltks
fyeaykgkgaylngrkikvkdfnpnnivisyypskkidleklrnkvkrvrifgafglemc
yvakgtldavfdvrpkvravdiassyiickeagalitdengdelkfdlnatdrlniivan
skemldiildll

SCOP Domain Coordinates for d1g0ib_:

Click to download the PDB-style file with coordinates for d1g0ib_.
(The format of our PDB-style files is described here.)

Timeline for d1g0ib_: