Lineage for d1g0ha_ (1g0h A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1055431Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 1055432Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 1055433Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 1055442Protein Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase [56665] (4 species)
  7. 1055454Species Methanococcus jannaschii [TaxId:2190] [56666] (3 PDB entries)
    MJ0109
    structural genomics
  8. 1055455Domain d1g0ha_: 1g0h A: [60171]
    complexed with ca, ipd

Details for d1g0ha_

PDB Entry: 1g0h (more details), 2.3 Å

PDB Description: crystal structure of mj0109 gene product inositol monophosphatase-fructose 1,6 bisphosphatase
PDB Compounds: (A:) inositol monophosphatase

SCOPe Domain Sequences for d1g0ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0ha_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Methanococcus jannaschii [TaxId: 2190]}
mkwdeigkniakeiekeilpyfgrkdksyvvgtspsgdeteifdkisedialkylkslnv
nivseelgvidnssewtvvidpidgsfnfingipffafcfgvfknnepyygltyefltks
fyeaykgkgaylngrkikvkdfnpnnivisyypskkidleklrnkvkrvrifgafglemc
yvakgtldavfdvrpkvravdiassyiickeagalitdengdelkfdlnatdrlniivan
skemldiildll

SCOPe Domain Coordinates for d1g0ha_:

Click to download the PDB-style file with coordinates for d1g0ha_.
(The format of our PDB-style files is described here.)

Timeline for d1g0ha_: