SCOP 1.57: Domain d1fzva_: 1fzv A:

Lineage for d1fzva_ (1fzv A:)

1. Root: SCOP 1.57

2. Class g: Small proteins [56992] (56 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (5 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)

6. Protein Placenta growth factor-1, PLGF-1 [64560] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64561] (1 PDB entry)

8. Domain d1fzva_: 1fzv A: [60159]

Details for d1fzva_

PDB Entry: 1fzv, 2 Å

PDB Description: the crystal structure of human placenta growth factor-1 (plgf-1), an angiogenic protein at 2.0a resolution

SCOP Domain Sequences for d1fzva_:

Sequence; same for both SEQRES and ATOM records:

>d1fzva_ g.17.1.1 (A:) Placenta growth factor-1, PLGF-1 {Human (Homo sapiens)}
ssevevvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhc
vpvetanvtmqllkirsgdrpsyveltfsqhvrcecrplr

Timeline for d1fzva_:

• d1fzva_ is new in SCOP 1.57
  
• d1fzva_ appears in SCOP 1.59
  
• d1fzva_ appears in the current release, SCOPe 2.08