PDB entry 1fzv

View 1fzv on RCSB PDB site
Description: the crystal structure of human placenta growth factor-1 (plgf-1), an angiogenic protein at 2.0a resolution
Deposited on 2000-10-04, released 2001-05-09
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-09, with a file datestamp of 2001-05-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1fzva_
  • Chain 'B':
    Domains in SCOP 1.57: d1fzvb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fzvA (A:)
    ssevevvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhc
    vpvetanvtmqllkirsgdrpsyveltfsqhvrcecrplr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fzvB (B:)
    ssevevvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhc
    vpvetanvtmqllkirsgdrpsyveltfsqhvrcecrplr