Lineage for d1fzkb_ (1fzk B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2746421Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 2746429Domain d1fzkb_: 1fzk B: [60151]
    Other proteins in same PDB: d1fzka1, d1fzka2
    complexed with mpd, mrd, nag, po4; mutant

Details for d1fzkb_

PDB Entry: 1fzk (more details), 1.7 Å

PDB Description: mhc class i natural mutant h-2kbm1 heavy chain complexed with beta-2 microglobulin and sendai virus nucleoprotein
PDB Compounds: (B:) protein (beta-2-microglobulin)

SCOPe Domain Sequences for d1fzkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzkb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1fzkb_:

Click to download the PDB-style file with coordinates for d1fzkb_.
(The format of our PDB-style files is described here.)

Timeline for d1fzkb_: