SCOP 1.57: Domain d1fzkb1: 1fzk B:

Lineage for d1fzkb1 (1fzk B:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (15 PDB entries)

8. Domain d1fzkb1: 1fzk B: [60151]
   Other proteins in same PDB: d1fzka2

Details for d1fzkb1

PDB Entry: 1fzk, 1.7 Å

PDB Description: mhc class i natural mutant h-2kbm1 heavy chain complexed with beta-2 microglobulin and sendai virus nucleoprotein

SCOP Domain Sequences for d1fzkb1:

Sequence; same for both SEQRES and ATOM records:

>d1fzkb1 b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1fzkb1:

• d1fzkb1 is new in SCOP 1.57
  
• d1fzkb1 appears in SCOP 1.59
  
• d1fzkb1 appears in the current release, SCOPe 2.08, called d1fzkb_