SCOPe 2.02: Domain d1fzhe_: 1fzh E:

Lineage for d1fzhe_ (1fzh E:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries)

8. Domain d1fzhe_: 1fzh E: [60138]
   Other proteins in same PDB: d1fzha_, d1fzhb_, d1fzhc_, d1fzhd_
   complexed with ca, fe, xe

Details for d1fzhe_

PDB Entry: 1fzh, 2.6 Å

PDB Description: methane monooxygenase hydroxylase, form ii pressurized with xenon gas

PDB Compounds: (E:) methane monooxygenase component a, gamma chain

SCOPe Domain Sequences for d1fzhe_:

Sequence; same for both SEQRES and ATOM records:

>d1fzhe_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlq

Timeline for d1fzhe_:

• d1fzhe_ first appeared in SCOP 1.57
  
• d1fzhe_ appears in SCOPe 2.01
  
• d1fzhe_ appears in SCOPe 2.03
  
• d1fzhe_ appears in the current release, SCOPe 2.08