Lineage for d1fv3b2 (1fv3 B:1111-1315)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111051Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 111244Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 111273Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins)
  6. 111281Protein Tetanus neurotoxin [50400] (1 species)
  7. 111282Species Clostridium tetani [50401] (8 PDB entries)
  8. 111290Domain d1fv3b2: 1fv3 B:1111-1315 [60041]
    Other proteins in same PDB: d1fv3a1, d1fv3b1

Details for d1fv3b2

PDB Entry: 1fv3 (more details), 2.3 Å

PDB Description: the hc fragment of tetanus toxin complexed with an analogue of its ganglioside receptor gt1b

SCOP Domain Sequences for d1fv3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fv3b2 b.42.4.2 (B:1111-1315) Tetanus neurotoxin {Clostridium tetani}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd

SCOP Domain Coordinates for d1fv3b2:

Click to download the PDB-style file with coordinates for d1fv3b2.
(The format of our PDB-style files is described here.)

Timeline for d1fv3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fv3b1