SCOP 1.57: Domain d1ftfa_: 1ftf A:

Lineage for d1ftfa_ (1ftf A:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (2 families)

5. Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)

6. Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [64421] (3 PDB entries)

8. Domain d1ftfa_: 1ftf A: [60025]

Details for d1ftfa_

PDB Entry: 1ftf, 2.05 Å

PDB Description: crystal structure of streptococcus pneumoniae acyl carrier protein synthase (native 2)

SCOP Domain Sequences for d1ftfa_:

Sequence; same for both SEQRES and ATOM records:

>d1ftfa_ d.150.1.2 (A:) Holo-(acyl carrier protein) synthase ACPS {Streptococcus pneumoniae}
mivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsakeaf
skamgtgisklgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvilee

Timeline for d1ftfa_:

• d1ftfa_ is new in SCOP 1.57
  
• d1ftfa_ appears in SCOP 1.59
  
• d1ftfa_ appears in the current release, SCOPe 2.08