Lineage for d1fsyb_ (1fsy B:)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 200057Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
  4. 200058Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 200059Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins)
  6. 200060Protein AMPC beta-Lactamase, class C [56618] (3 species)
  7. 200073Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (24 PDB entries)
  8. 200087Domain d1fsyb_: 1fsy B: [60017]

Details for d1fsyb_

PDB Entry: 1fsy (more details), 1.75 Å

PDB Description: ampc beta-lactamase from e. coli complexed with inhibitor cloxacillinboronic acid

SCOP Domain Sequences for d1fsyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsyb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnala

SCOP Domain Coordinates for d1fsyb_:

Click to download the PDB-style file with coordinates for d1fsyb_.
(The format of our PDB-style files is described here.)

Timeline for d1fsyb_: