![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) ![]() automatically mapped to Pfam PF03951 |
![]() | Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein) |
![]() | Protein Glutamine synthetase, N-terminal domain [54370] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries) |
![]() | Domain d1fpyg1: 1fpy G:1-100 [59964] Other proteins in same PDB: d1fpya2, d1fpyb2, d1fpyc2, d1fpyd2, d1fpye2, d1fpyf2, d1fpyg2, d1fpyh2, d1fpyi2, d1fpyj2, d1fpyk2, d1fpyl2 complexed with adp, mn, ppq |
PDB Entry: 1fpy (more details), 2.89 Å
SCOPe Domain Sequences for d1fpyg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fpyg1 d.15.9.1 (G:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi nesdmvlmpdastavidpffadstliircdilepgtlqgy
Timeline for d1fpyg1: