SCOPe 2.08: Domain d1fpyg1: 1fpy G:1-100

Lineage for d1fpyg1 (1fpy G:1-100)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families)
   automatically mapped to Pfam PF03951

5. Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)

6. Protein Glutamine synthetase, N-terminal domain [54370] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)

8. Domain d1fpyg1: 1fpy G:1-100 [59964]
   Other proteins in same PDB: d1fpya2, d1fpyb2, d1fpyc2, d1fpyd2, d1fpye2, d1fpyf2, d1fpyg2, d1fpyh2, d1fpyi2, d1fpyj2, d1fpyk2, d1fpyl2
   complexed with adp, mn, ppq

Details for d1fpyg1

PDB Entry: 1fpy, 2.89 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium with inhibitor phosphinothricin

PDB Compounds: (G:) glutamine synthetase

SCOPe Domain Sequences for d1fpyg1:

Sequence; same for both SEQRES and ATOM records:

>d1fpyg1 d.15.9.1 (G:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

Timeline for d1fpyg1:

• d1fpyg1 first appeared in SCOP 1.57
  
• d1fpyg1 appears in SCOPe 2.07