Lineage for d1fpyl1 (1fpy L:1-100)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934813Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 2934814Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 2934815Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. 2934865Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)
  8. 2934925Domain d1fpyl1: 1fpy L:1-100 [59974]
    Other proteins in same PDB: d1fpya2, d1fpyb2, d1fpyc2, d1fpyd2, d1fpye2, d1fpyf2, d1fpyg2, d1fpyh2, d1fpyi2, d1fpyj2, d1fpyk2, d1fpyl2
    complexed with adp, mn, ppq

Details for d1fpyl1

PDB Entry: 1fpy (more details), 2.89 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium with inhibitor phosphinothricin
PDB Compounds: (L:) glutamine synthetase

SCOPe Domain Sequences for d1fpyl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpyl1 d.15.9.1 (L:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

SCOPe Domain Coordinates for d1fpyl1:

Click to download the PDB-style file with coordinates for d1fpyl1.
(The format of our PDB-style files is described here.)

Timeline for d1fpyl1: