Lineage for d1fpxa2 (1fpx A:109-352)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125563Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
  4. 125564Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (18 families) (S)
  5. 125698Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (2 proteins)
  6. 125703Protein Isoflavone O-methyltransferase [64114] (1 species)
  7. 125704Species Alfalfa (Medicago sativa) [TaxId:3879] [64115] (2 PDB entries)
  8. 125706Domain d1fpxa2: 1fpx A:109-352 [59951]
    Other proteins in same PDB: d1fpxa1

Details for d1fpxa2

PDB Entry: 1fpx (more details), 1.65 Å

PDB Description: crystal structure analysis of selenomethionine substituted isoflavone o-methyltransferase

SCOP Domain Sequences for d1fpxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpxa2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa)}
lclapmvecvldptlsgsyhelkkwiyeedltlfgvtlgsgfwdfldknpeyntsfndam
asdsklinlalrdcdfvfdglesivdvgggtgttakiicetfpklkcivfdrpqvvenls
gsnnltyvggdmftsipnadavllkyilhnwtdkdclrilkkckeavtndgkrgkvtiid
mvidkkkdenqvtqikllmdvnmaclngkerneeewkklfieagfqhykispltgflsli
eiyp

SCOP Domain Coordinates for d1fpxa2:

Click to download the PDB-style file with coordinates for d1fpxa2.
(The format of our PDB-style files is described here.)

Timeline for d1fpxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fpxa1