Lineage for d1fp2a1 (1fp2 A:8-108)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 95173Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (32 families) (S)
  5. 95502Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (2 proteins)
  6. 95507Protein Isoflavone O-methyltransferase [63478] (1 species)
  7. 95508Species Alfalfa (Medicago sativa) [TaxId:3879] [63479] (2 PDB entries)
  8. 95509Domain d1fp2a1: 1fp2 A:8-108 [59941]
    Other proteins in same PDB: d1fp2a2

Details for d1fp2a1

PDB Entry: 1fp2 (more details), 1.4 Å

PDB Description: crystal structure analysis of isoflavone o-methyltransferase

SCOP Domain Sequences for d1fp2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fp2a1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa)}
rkpseifkaqallykhiyafidsmslkwavemnipniiqnhgkpislsnlvsilqvpssk
ignvrrlmrylahngffeiitkeeesyaltvasellvrgsd

SCOP Domain Coordinates for d1fp2a1:

Click to download the PDB-style file with coordinates for d1fp2a1.
(The format of our PDB-style files is described here.)

Timeline for d1fp2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fp2a2