SCOP 1.61: Domain d1fp1d1: 1fp1 D:19-128

Lineage for d1fp1d1 (1fp1 D:19-128)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (35 families)

5. Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (3 proteins)

6. Protein Chalcone O-methyltransferase [63476] (1 species)

7. Species Alfalfa (Medicago sativa) [TaxId:3879] [63477] (2 PDB entries)

8. Domain d1fp1d1: 1fp1 D:19-128 [59939]
   Other proteins in same PDB: d1fp1d2

Details for d1fp1d1

PDB Entry: 1fp1, 1.82 Å

PDB Description: crystal structure analysis of chalcone o-methyltransferase

SCOP Domain Sequences for d1fp1d1:

Sequence; same for both SEQRES and ATOM records:

>d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa)}
qtedsaclsamvlttnlvypavlnaaidlnlfeiiakatppgafmspseiasklpastqh
sdlpnrldrmlrllasysvltsttrtiedggaervyglsmvgkylvpdes

Timeline for d1fp1d1:

• d1fp1d1 first appeared in SCOP 1.57
  
• d1fp1d1 appears in SCOP 1.59
  
• d1fp1d1 appears in SCOP 1.63
  
• d1fp1d1 appears in the current release, SCOPe 2.08