SCOP 1.59: Domain d1fngc2: 1fng C:1-81

Lineage for d1fngc2 (1fng C:1-81)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins)

6. Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (11 species)

7. Species Mouse (Mus musculus), I-EK [TaxId:10090] [54465] (5 PDB entries)

8. Domain d1fngc2: 1fng C:1-81 [59909]
   Other proteins in same PDB: d1fnga1, d1fngb1, d1fngc1, d1fngd1

Details for d1fngc2

PDB Entry: 1fng, 1.9 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1fngc2:

Sequence; same for both SEQRES and ATOM records:

>d1fngc2 d.19.1.1 (C:1-81) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavdkanldvmkersnntp

Timeline for d1fngc2:

• d1fngc2 first appeared in SCOP 1.57
  
• d1fngc2 appears in SCOP 1.61
  
• d1fngc2 appears in the current release, SCOPe 2.08