SCOPe 2.08: Domain d1fn4c1: 1fn4 C:1-107

Lineage for d1fn4c1 (1fn4 C:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88532] (14 PDB entries)

8. Domain d1fn4c1: 1fn4 C:1-107 [59888]
   Other proteins in same PDB: d1fn4a2, d1fn4b1, d1fn4b2, d1fn4c2, d1fn4d1, d1fn4d2
   part of Fab 198 against acetylcholine receptor

Details for d1fn4c1

PDB Entry: 1fn4, 2.8 Å

PDB Description: crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies

PDB Compounds: (C:) monoclonal antibody against acetylcholine receptor

SCOPe Domain Sequences for d1fn4c1:

Sequence; same for both SEQRES and ATOM records:

>d1fn4c1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dikltqspsllsasvgdrvtlsckgsqninnylawyqqklgeapklliyntnslqtgips
rfsgsgsgtdytltisslqpedvatyfcyqynngytfgagtklelkr

Timeline for d1fn4c1:

• d1fn4c1 first appeared in SCOP 1.57
  
• d1fn4c1 appears in SCOPe 2.07