Lineage for d1fn4b2 (1fn4 B:107-208)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1515183Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1516056Species Norway rat (Rattus norvegicus) [TaxId:10116] [88578] (5 PDB entries)
  8. 1516067Domain d1fn4b2: 1fn4 B:107-208 [59887]
    Other proteins in same PDB: d1fn4a1, d1fn4a2, d1fn4b1, d1fn4c1, d1fn4c2, d1fn4d1
    part of Fab 198 against acetylcholine receptor

Details for d1fn4b2

PDB Entry: 1fn4 (more details), 2.8 Å

PDB Description: crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies
PDB Compounds: (B:) monoclonal antibody against acetylcholine receptor

SCOPe Domain Sequences for d1fn4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fn4b2 b.1.1.2 (B:107-208) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tmvtvssvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsg
lytltssvtvpsstwssqavtcnvahpasstkvdkkivprdc

SCOPe Domain Coordinates for d1fn4b2:

Click to download the PDB-style file with coordinates for d1fn4b2.
(The format of our PDB-style files is described here.)

Timeline for d1fn4b2: