SCOPe 2.07: Domain d1fmlb_: 1fml B:

Lineage for d1fmlb_ (1fml B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
   Pfam PF00685
   similar to the nucleotide/nucleoside kinases but transfer sulphate group

6. Protein Retinol dehydratase [64015] (1 species)

7. Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [64016] (2 PDB entries)

8. Domain d1fmlb_: 1fml B: [59882]
   complexed with a3p, ca, rtl

Details for d1fmlb_

PDB Entry: 1fml, 2.75 Å

PDB Description: crystal structure of retinol dehydratase in a complex with retinol and pap

PDB Compounds: (B:) retinol dehydratase

SCOPe Domain Sequences for d1fmlb_:

Sequence; same for both SEQRES and ATOM records:

>d1fmlb_ c.37.1.5 (B:) Retinol dehydratase {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
lpfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmplrptdv
fvasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeeyndilpn
penldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkmvylard
prdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhdpnmlfl
fyedylkdlpgciariadflgkklseeqiqrlcehlnfekfknngavnmedyreigilad
gehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlryp

Timeline for d1fmlb_:

• d1fmlb_ first appeared in SCOP 1.57
  
• d1fmlb_ appears in SCOPe 2.06
  
• d1fmlb_ appears in the current release, SCOPe 2.08