Lineage for d1fjda_ (1fjd A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548395Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2548597Protein Parvulin [64248] (1 species)
  7. 2548598Species Human (Homo sapiens), hpar14 [TaxId:9606] [64249] (2 PDB entries)
  8. 2548600Domain d1fjda_: 1fjd A: [59851]

Details for d1fjda_

PDB Entry: 1fjd (more details)

PDB Description: human parvulin-like peptidyl prolyl cis/trans isomerase, hpar14
PDB Compounds: (A:) peptidyl prolyl cis/trans isomerase (ppiase)

SCOPe Domain Sequences for d1fjda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjda_ d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]}
gsgpkgggnavkvrhilcekhgkimeameklksgmrfnevaaqysedkarqggdlgwmtr
gsmvgpfqeaafalpvsgmdkpvftdppvktkfgyhiimvegrk

SCOPe Domain Coordinates for d1fjda_:

Click to download the PDB-style file with coordinates for d1fjda_.
(The format of our PDB-style files is described here.)

Timeline for d1fjda_: