Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins) |
Protein Germin [63853] (1 species) Metal (manganese)-binding protein with oxalate oxidase and superoxide dismutase activities; homohexamer |
Species Barley (Hordeum vulgare) [TaxId:4513] [63854] (4 PDB entries) |
Domain d1fi2a_: 1fi2 A: [59845] complexed with mn |
PDB Entry: 1fi2 (more details), 1.6 Å
SCOPe Domain Sequences for d1fi2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fi2a_ b.82.1.2 (A:) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} tdpdplqdfcvadldgkavsvnghtckpmseagddflfsskltkagntstpngsavteld vaewpgtntlgvsmnrvdfapggtnpphihprateigmvmkgellvgilgsldsgnklys rvvragetfviprglmhfqfnvgkteaymvvsfnsqnpgivfvpltlfgsdppiptpvlt kalrveagvvellkskfaggs
Timeline for d1fi2a_: