Lineage for d1fi2a_ (1fi2 A:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies) 
Superfamily b.82.1: RmlC-like [51182] (4 families) 
Family b.82.1.2: Germin/Seed storage 7S protein [51187] (2 proteins) Protein Germin [63853] (1 species) Species Barley (Hordeum vulgare) [TaxId:4513] [63854] (1 PDB entry) 
Domain d1fi2a_: 1fi2 A: [59845]
Details for d1fi2a_
PDB Entry: 1fi2 (more details), 1.6 Å
PDB Description: crystal structure of germin (oxalate oxidase)
SCOP Domain Sequences for d1fi2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fi2a_ b.82.1.2 (A:) Germin {Barley (Hordeum vulgare)}
tdpdplqdfcvadldgkavsvnghtckpmseagddflfsskltkagntstpngsavteld
vaewpgtntlgvsmnrvdfapggtnpphihprateigmvmkgellvgilgsldsgnklys
rvvragetfviprglmhfqfnvgkteaymvvsfnsqnpgivfvpltlfgsdppiptpvlt
kalrveagvvellkskfaggs
SCOP Domain Coordinates for d1fi2a_:
Click to download the PDB-style file with coordinates for d1fi2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fi2a_:
- d1fi2a_ is new in SCOP 1.57
- d1fi2a_ appears in SCOP 1.59
- d1fi2a_ appears in the current release, SCOPe 2.08
View in 3D