SCOPe 2.06: Domain d1f9ka_: 1f9k A:

Lineage for d1f9ka_ (1f9k A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId:3891] [63728] (2 PDB entries)

8. Domain d1f9ka_: 1f9k A: [59741]
   complexed with amg, ca, mn

Details for d1f9ka_

PDB Entry: 1f9k, 3 Å

PDB Description: winged bean acidic lectin complexed with methyl-alpha-d-galactose

PDB Compounds: (A:) acidic lectin

SCOPe Domain Sequences for d1f9ka_:

Sequence; same for both SEQRES and ATOM records:

>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]}
etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftssl

Timeline for d1f9ka_:

• d1f9ka_ first appeared in SCOP 1.57
  
• d1f9ka_ appears in SCOPe 2.05
  
• d1f9ka_ appears in SCOPe 2.07
  
• d1f9ka_ appears in the current release, SCOPe 2.08