SCOP 1.75: Domain d1f46a_: 1f46 A:

Lineage for d1f46a_ (1f46 A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family)
   contains a single copy of this fold

5. Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (1 protein)

6. Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species)

7. Species Escherichia coli [TaxId:562] [64386] (8 PDB entries)

8. Domain d1f46a_: 1f46 A: [59643]

Details for d1f46a_

PDB Entry: 1f46, 1.5 Å

PDB Description: the bacterial cell-division protein zipa and its interaction with an ftsz fragment revealed by x-ray crystallography

PDB Compounds: (A:) cell division protein zipa

SCOP Domain Sequences for d1f46a_:

Sequence; same for both SEQRES and ATOM records:

>d1f46a_ d.129.4.1 (A:) Cell-division protein ZipA, C-terminal domain {Escherichia coli [TaxId: 562]}
rkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmv
kpgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddqrrmmt
pqklreyqdiirevkdana

Timeline for d1f46a_:

• d1f46a_ first appeared in SCOP 1.57
  
• d1f46a_ appears in SCOP 1.73
  
• d1f46a_ appears in SCOPe 2.01
  
• d1f46a_ appears in the current release, SCOPe 2.08