Lineage for d1f46a_ (1f46 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2976179Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) (S)
    contains a single copy of this fold
    automatically mapped to Pfam PF04354
  5. 2976180Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (2 proteins)
  6. 2976181Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species)
  7. 2976182Species Escherichia coli [TaxId:562] [64386] (6 PDB entries)
  8. 2976183Domain d1f46a_: 1f46 A: [59643]

Details for d1f46a_

PDB Entry: 1f46 (more details), 1.5 Å

PDB Description: the bacterial cell-division protein zipa and its interaction with an ftsz fragment revealed by x-ray crystallography
PDB Compounds: (A:) cell division protein zipa

SCOPe Domain Sequences for d1f46a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f46a_ d.129.4.1 (A:) Cell-division protein ZipA, C-terminal domain {Escherichia coli [TaxId: 562]}
rkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmv
kpgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddqrrmmt
pqklreyqdiirevkdana

SCOPe Domain Coordinates for d1f46a_:

Click to download the PDB-style file with coordinates for d1f46a_.
(The format of our PDB-style files is described here.)

Timeline for d1f46a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f46b_