Lineage for d1f2ik1 (1f2i K:5096-5131)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035159Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 3035280Protein ZIF268 [57669] (1 species)
    duplication: consists of 3 fingers
  7. 3035281Species Mouse (Mus musculus) [TaxId:10090] [57670] (14 PDB entries)
  8. 3035329Domain d1f2ik1: 1f2i K:5096-5131 [59621]
    protein/DNA complex; complexed with zn

Details for d1f2ik1

PDB Entry: 1f2i (more details), 2.35 Å

PDB Description: cocrystal structure of selected zinc finger dimer bound to dna
PDB Compounds: (K:) fusion of n-terminal 17-mer peptide extension to zif12

SCOPe Domain Sequences for d1f2ik1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2ik1 g.37.1.1 (K:5096-5131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]}
nyvvpkmrpyacpvescdrrfsrsdeltrhirihtg

SCOPe Domain Coordinates for d1f2ik1:

Click to download the PDB-style file with coordinates for d1f2ik1.
(The format of our PDB-style files is described here.)

Timeline for d1f2ik1: